PDB entry 4zby

View 4zby on RCSB PDB site
Description: Family 4 uracil-DNA glycosylase from Sulfolobus tokodaii (uracil complex form)
Class: hydrolase
Keywords: Uracil-DNA glycosylase, DNA repair, HYDROLASE
Deposited on 2015-04-15, released 2015-09-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Sulfolobus tokodaii str. 7 [TaxId:273063]
    Gene: STK_22380
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4zbya_
  • Heterogens: SF4, URA, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zbyA (A:)
mdslekikeevisckkcklwqfrtnavpgegypkaeimfvgeapgenedkegrpfvgaag
klltqmikeilglerdqvfitnvvkcrppnnrdpeedeitacspyldrqidiimpkiivt
lgrhstkyifskmgenfssitkvrgksyvwkykekeiivfptyhpaaalynpnlrkilee
dfkkirelaitpkr