Class a: All alpha proteins [46456] (289 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
Protein automated matches [190675] (10 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:273075] [276610] (1 PDB entry) |
Domain d4yboc_: 4ybo C: [276614] Other proteins in same PDB: d4yboa2, d4ybod2 automated match to d2ifcc_ complexed with bct |
PDB Entry: 4ybo (more details), 2.18 Å
SCOPe Domain Sequences for d4yboc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yboc_ a.103.1.1 (C:) automated matches {Thermoplasma acidophilum [TaxId: 273075]} eeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpteq elrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrdv aaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntalil ytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamve kwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledfg ikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrli rpravyvgpaerkyvpiaer
Timeline for d4yboc_: