SCOPe 2.05: Domain d4yboc_: 4ybo C:

Lineage for d4yboc_ (4ybo C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein automated matches [190675] (6 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:273075] [276610] (1 PDB entry)

8. Domain d4yboc_: 4ybo C: [276614]
   automated match to d2ifcc_
   complexed with bct

Details for d4yboc_

PDB Entry: 4ybo, 2.18 Å

PDB Description: structure of citrate synthase from the thermoacidophilic euryarchaeon thermolasma acidophilum

PDB Compounds: (C:) citrate synthase

SCOPe Domain Sequences for d4yboc_:

Sequence; same for both SEQRES and ATOM records:

>d4yboc_ a.103.1.1 (C:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
eeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpteq
elrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrdv
aaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntalil
ytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamve
kwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledfg
ikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrli
rpravyvgpaerkyvpiaer

Timeline for d4yboc_:

• d4yboc_ is new in SCOPe 2.05-stable
  
• d4yboc_ appears in SCOPe 2.06
  
• d4yboc_ appears in the current release, SCOPe 2.08