Lineage for d4ybob_ (4ybo B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336030Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2336031Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2336032Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2336098Protein automated matches [190675] (10 species)
    not a true protein
  7. 2336141Species Thermoplasma acidophilum [TaxId:273075] [276610] (1 PDB entry)
  8. 2336143Domain d4ybob_: 4ybo B: [276612]
    Other proteins in same PDB: d4yboa2, d4ybod2
    automated match to d2ifcc_
    complexed with bct

Details for d4ybob_

PDB Entry: 4ybo (more details), 2.18 Å

PDB Description: structure of citrate synthase from the thermoacidophilic euryarchaeon thermolasma acidophilum
PDB Compounds: (B:) citrate synthase

SCOPe Domain Sequences for d4ybob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ybob_ a.103.1.1 (B:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
eeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpteq
elrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrdv
aaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntalil
ytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamve
kwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledfg
ikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrli
rpravyvgpaerkyvpiaerk

SCOPe Domain Coordinates for d4ybob_:

Click to download the PDB-style file with coordinates for d4ybob_.
(The format of our PDB-style files is described here.)

Timeline for d4ybob_: