SCOPe 2.08: Domain d5abvc1: 5abv C:69-248

Lineage for d5abvc1 (5abv C:69-248)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries)

8. Domain d5abvc1: 5abv C:69-248 [276481]
   Other proteins in same PDB: d5abva2, d5abvc2, d5abve2, d5abvg2
   automated match to d2v8ye1

Details for d5abvc1

PDB Entry: 5abv, 2.13 Å

PDB Description: complex of d. melanogaster eif4e with the 4e-binding protein mextli

PDB Compounds: (C:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d5abvc1:

Sequence, based on SEQRES records:

>d5abvc1 d.86.1.0 (C:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvksiytl

Sequence, based on observed residues (ATOM records):

>d5abvc1 d.86.1.0 (C:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlssktdldnlwldvllcligeafdhsdqicgavinirsn
kisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkvksiytl

Timeline for d5abvc1:

• d5abvc1 first appeared in SCOPe 2.05, called d5abvc_
  
• d5abvc1 appears in SCOPe 2.07