Lineage for d5abvc_ (5abv C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916685Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 1916686Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 1916739Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 1916740Protein automated matches [190708] (7 species)
    not a true protein
  7. 1916749Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (6 PDB entries)
  8. 1916754Domain d5abvc_: 5abv C: [276481]
    automated match to d2v8ye1

Details for d5abvc_

PDB Entry: 5abv (more details), 2.13 Å

PDB Description: complex of d. melanogaster eif4e with the 4e-binding protein mextli
PDB Compounds: (C:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d5abvc_:

Sequence, based on SEQRES records: (download)

>d5abvc_ d.86.1.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hmkhplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdysl
fkknirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavin
irgksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvksiy
tl

Sequence, based on observed residues (ATOM records): (download)

>d5abvc_ d.86.1.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hmkhplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdysl
fkknirpmwedaankqggrwvitlssktdldnlwldvllcligeafdhsdqicgavinir
snkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkvksiytl

SCOPe Domain Coordinates for d5abvc_:

Click to download the PDB-style file with coordinates for d5abvc_.
(The format of our PDB-style files is described here.)

Timeline for d5abvc_: