SCOPe 2.05: Domain d5ctob1: 5cto B:30-193

Lineage for d5ctob1 (5cto B:30-193)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (18 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [276308] (1 PDB entry)

8. Domain d5ctob1: 5cto B:30-193 [276315]
   Other proteins in same PDB: d5ctoa2, d5ctob2, d5ctoc2, d5ctod2
   automated match to d1sp9b1
   complexed with fe, ntd

Details for d5ctob1

PDB Entry: 5cto, 2.62 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with ntbc

PDB Compounds: (B:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5ctob1:

Sequence, based on SEQRES records:

>d5ctob1 d.32.1.0 (B:30-193) automated matches {Arabidopsis thaliana [TaxId: 3702]}
skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
ltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaieveda
esafsisvangaipssppivlneavtiaevklygdvvlryvsyk

Sequence, based on observed residues (ATOM records):

>d5ctob1 d.32.1.0 (B:30-193) automated matches {Arabidopsis thaliana [TaxId: 3702]}
skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
ltsgdlrflftapyspsltttasipsfdhgscrsffsshglgvravaievedaesafsis
vangaipssppivlneavtiaevklygdvvlryvsyk

Timeline for d5ctob1:

• d5ctob1 is new in SCOPe 2.05-stable
  
• d5ctob1 appears in SCOPe 2.06
  
• d5ctob1 last appears in SCOPe 2.07