SCOPe 2.05: Domain d5ctod2: 5cto D:201-434

Lineage for d5ctod2 (5cto D:201-434)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein automated matches [276310] (2 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [276311] (1 PDB entry)

8. Domain d5ctod2: 5cto D:201-434 [276312]
   Other proteins in same PDB: d5ctoa1, d5ctob1, d5ctoc1, d5ctod1
   automated match to d1sp9b2
   complexed with fe, ntd

Details for d5ctod2

PDB Entry: 5cto, 2.62 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with ntbc

PDB Compounds: (D:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5ctod2:

Sequence, based on SEQRES records:

>d5ctod2 d.32.1.3 (D:201-434) automated matches {Arabidopsis thaliana [TaxId: 3702]}
eflpgfervedassfpldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgt
aesglnsavlasndemvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtl
remrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqi
ftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfselfksieef

Sequence, based on observed residues (ATOM records):

>d5ctod2 d.32.1.3 (D:201-434) automated matches {Arabidopsis thaliana [TaxId: 3702]}
eflpgfervedfpldygirrldhavgnvpelgpaltyvagftgfhqfaefsglnsavlas
ndemvllpinepvhgrksqiqtylehnegaglqhlalmsedifrtlremrkrssiggfdf
mpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqiftkplgdrptifie
iiqrvgcmmyqsggcggfgkgnfselfksieef

Timeline for d5ctod2:

• d5ctod2 is new in SCOPe 2.05-stable
  
• d5ctod2 appears in SCOPe 2.06
  
• d5ctod2 last appears in SCOPe 2.07