Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein automated matches [276310] (2 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [276311] (1 PDB entry) |
Domain d5ctod2: 5cto D:201-434 [276312] Other proteins in same PDB: d5ctoa1, d5ctob1, d5ctoc1, d5ctod1 automated match to d1sp9b2 complexed with fe, ntd |
PDB Entry: 5cto (more details), 2.62 Å
SCOPe Domain Sequences for d5ctod2:
Sequence, based on SEQRES records: (download)
>d5ctod2 d.32.1.3 (D:201-434) automated matches {Arabidopsis thaliana [TaxId: 3702]} eflpgfervedassfpldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgt aesglnsavlasndemvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtl remrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqi ftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfselfksieef
>d5ctod2 d.32.1.3 (D:201-434) automated matches {Arabidopsis thaliana [TaxId: 3702]} eflpgfervedfpldygirrldhavgnvpelgpaltyvagftgfhqfaefsglnsavlas ndemvllpinepvhgrksqiqtylehnegaglqhlalmsedifrtlremrkrssiggfdf mpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqiftkplgdrptifie iiqrvgcmmyqsggcggfgkgnfselfksieef
Timeline for d5ctod2: