Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [276308] (1 PDB entry) |
Domain d5ctob1: 5cto B:30-193 [276315] Other proteins in same PDB: d5ctoa2, d5ctob2, d5ctoc2, d5ctod2 automated match to d1sp9b1 complexed with fe, ntd |
PDB Entry: 5cto (more details), 2.62 Å
SCOPe Domain Sequences for d5ctob1:
Sequence, based on SEQRES records: (download)
>d5ctob1 d.32.1.0 (B:30-193) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl ltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaieveda esafsisvangaipssppivlneavtiaevklygdvvlryvsyk
>d5ctob1 d.32.1.0 (B:30-193) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl ltsgdlrflftapyspsltttasipsfdhgscrsffsshglgvravaievedaesafsis vangaipssppivlneavtiaevklygdvvlryvsyk
Timeline for d5ctob1: