Lineage for d5cm7b1 (5cm7 B:2-136)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914717Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1914789Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 1914790Protein automated matches [226901] (8 species)
    not a true protein
  7. 1914791Species Acinetobacter baumannii [TaxId:470] [276302] (3 PDB entries)
  8. 1914793Domain d5cm7b1: 5cm7 B:2-136 [276306]
    Other proteins in same PDB: d5cm7a2, d5cm7b2
    automated match to d3mcqa1
    complexed with adp, ca, mg, na, tpp

Details for d5cm7b1

PDB Entry: 5cm7 (more details), 1.55 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp)
PDB Compounds: (B:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5cm7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cm7b1 d.79.4.0 (B:2-136) automated matches {Acinetobacter baumannii [TaxId: 470]}
aefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphaig
wksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdttq
gphltitvtamgwie

SCOPe Domain Coordinates for d5cm7b1:

Click to download the PDB-style file with coordinates for d5cm7b1.
(The format of our PDB-style files is described here.)

Timeline for d5cm7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cm7b2