Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) |
Family d.79.4.0: automated matches [227181] (1 protein) not a true family |
Protein automated matches [226901] (10 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [276302] (4 PDB entries) |
Domain d5cm7b1: 5cm7 B:2-136 [276306] Other proteins in same PDB: d5cm7a2, d5cm7b2 automated match to d3mcqa1 complexed with adp, ca, mg, na, tpp |
PDB Entry: 5cm7 (more details), 1.55 Å
SCOPe Domain Sequences for d5cm7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cm7b1 d.79.4.0 (B:2-136) automated matches {Acinetobacter baumannii [TaxId: 470]} aefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphaig wksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdttq gphltitvtamgwie
Timeline for d5cm7b1: