SCOPe 2.05: Domain d5cm7b2: 5cm7 B:137-305

Lineage for d5cm7b2 (5cm7 B:137-305)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (9 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [276304] (3 PDB entries)

8. Domain d5cm7b2: 5cm7 B:137-305 [276307]
   Other proteins in same PDB: d5cm7a1, d5cm7b1
   automated match to d3mcqa2
   complexed with adp, ca, mg, na, tpp

Details for d5cm7b2

PDB Entry: 5cm7, 1.55 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp)

PDB Compounds: (B:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5cm7b2:

Sequence; same for both SEQRES and ATOM records:

>d5cm7b2 d.139.1.0 (B:137-305) automated matches {Acinetobacter baumannii [TaxId: 470]}
tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm
idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti
tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgyqhfa

Timeline for d5cm7b2:

• d5cm7b2 is new in SCOPe 2.05-stable
  
• d5cm7b2 appears in SCOPe 2.06
  
• d5cm7b2 appears in the current release, SCOPe 2.08