SCOPe 2.05: Domain d1ei5a2: 1ei5 A:418-520

Lineage for d1ei5a2 (1ei5 A:418-520)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.3: D-aminopeptidase, middle and C-terminal domains [50886] (1 family)

5. Family b.61.3.1: D-aminopeptidase, middle and C-terminal domains [50887] (1 protein)

6. Protein D-aminopeptidase, middle and C-terminal domains [50888] (1 species)
   duplication: both domains have this barrel fold

7. Species Ochrobactrum anthropi [TaxId:529] [50889] (1 PDB entry)

8. Domain d1ei5a2: 1ei5 A:418-520 [27419]
   Other proteins in same PDB: d1ei5a3

Details for d1ei5a2

PDB Entry: 1ei5, 1.9 Å

PDB Description: crystal structure of a d-aminopeptidase from ochrobactrum anthropi

PDB Compounds: (A:) d-aminopeptidase

SCOPe Domain Sequences for d1ei5a2:

Sequence; same for both SEQRES and ATOM records:

>d1ei5a2 b.61.3.1 (A:418-520) D-aminopeptidase, middle and C-terminal domains {Ochrobactrum anthropi [TaxId: 529]}
vkgeakhdiigryhsdeldadlllvseggaiygafegflgksdmyplysvgsdvwllpvq
rsmdapspgewklvfrrddkgeitglsvgcwlargveyrrvqp

Timeline for d1ei5a2:

• d1ei5a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ei5a2 appears in SCOPe 2.04
  
• d1ei5a2 appears in SCOPe 2.06
  
• d1ei5a2 appears in the current release, SCOPe 2.08