PDB entry 1ei5

View 1ei5 on RCSB PDB site
Description: crystal structure of a d-aminopeptidase from ochrobactrum anthropi
Class: hydrolase
Keywords: d-aminopeptidase, penicillin binding protein, alpha/beta domain, beta barrel domain, hydrolase
Deposited on 2000-02-24, released 2000-10-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.163
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-aminopeptidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ei5a1, d1ei5a2, d1ei5a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ei5A (A:)
    mskfdtsaleafvrhipqnykgpggvvavvkdgevvlqhawgfadlrtrtpmtldtrmpi
    csvskqftcavlldavgepellddaleayldkfederpavrdlcnnqsglrdywalsvlc
    gadpegvflpaqaqsllrrlktthfepgshysycngnfriladlieahtgrtlvdilser
    ifapagmkraelisdtalfdectgyegdtvrgflpatnriqwmgdagicaslndmiaweq
    fidatrddesglyrrlsgpqtfkdgvaapygfglnlhetggkrltghggalrgwrcqrwh
    caderlstiamfnfeggasevafklmnialgvsssevsrveadsawfgswlddetglvls
    ledaghgrmkarfgtspemmdvvsanearsavttirrdgetielvrasenlrlsmkrvkg
    eakhdiigryhsdeldadlllvseggaiygafegflgksdmyplysvgsdvwllpvqrsm
    dapspgewklvfrrddkgeitglsvgcwlargveyrrvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ei5A (A:)
    kfdtsaleafvrhipqnykgpggvvavvkdgevvlqhawgfadlrtrtpmtldtrmpics
    vskqftcavlldavgepellddaleayldkfederpavrdlcnnqsglrdywalsvlcga
    dpegvflpaqaqsllrrlktthfepgshysycngnfriladlieahtgrtlvdilserif
    apagmkraelisdtalfdectgyegdtvrgflpatnriqwmgdagicaslndmiaweqfi
    datrddesglyrrlsgpqtfkdgvaapygfglnlhetggkrltghggalrgwrcqrwhca
    derlstiamfnfeggasevafklmnialgvsssevsrveadsawfgswlddetglvlsle
    daghgrmkarfgtspemmdvvsanearsavttirrdgetielvrasenlrlsmkrvkgea
    khdiigryhsdeldadlllvseggaiygafegflgksdmyplysvgsdvwllpvqrsmda
    pspgewklvfrrddkgeitglsvgcwlargveyrrvqp