Lineage for d1ei5a2 (1ei5 A:418-520)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16669Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 16868Superfamily b.61.3: D-aminopeptidase, middle and C-terminal domains [50886] (1 family) (S)
  5. 16869Family b.61.3.1: D-aminopeptidase, middle and C-terminal domains [50887] (1 protein)
  6. 16870Protein D-aminopeptidase, middle and C-terminal domains [50888] (1 species)
  7. 16871Species Ochrobactrum anthropi [TaxId:529] [50889] (1 PDB entry)
  8. 16873Domain d1ei5a2: 1ei5 A:418-520 [27419]
    Other proteins in same PDB: d1ei5a3

Details for d1ei5a2

PDB Entry: 1ei5 (more details), 1.9 Å

PDB Description: crystal structure of a d-aminopeptidase from ochrobactrum anthropi

SCOP Domain Sequences for d1ei5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ei5a2 b.61.3.1 (A:418-520) D-aminopeptidase, middle and C-terminal domains {Ochrobactrum anthropi}
vkgeakhdiigryhsdeldadlllvseggaiygafegflgksdmyplysvgsdvwllpvq
rsmdapspgewklvfrrddkgeitglsvgcwlargveyrrvqp

SCOP Domain Coordinates for d1ei5a2:

Click to download the PDB-style file with coordinates for d1ei5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ei5a2: