Class b: All beta proteins [48724] (93 folds) |
Fold b.61: Streptavidin-like [50875] (3 superfamilies) |
Superfamily b.61.3: D-aminopeptidase, middle and C-terminal domains [50886] (1 family) |
Family b.61.3.1: D-aminopeptidase, middle and C-terminal domains [50887] (1 protein) |
Protein D-aminopeptidase, middle and C-terminal domains [50888] (1 species) |
Species Ochrobactrum anthropi [TaxId:529] [50889] (1 PDB entry) |
Domain d1ei5a2: 1ei5 A:418-520 [27419] Other proteins in same PDB: d1ei5a3 |
PDB Entry: 1ei5 (more details), 1.9 Å
SCOP Domain Sequences for d1ei5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ei5a2 b.61.3.1 (A:418-520) D-aminopeptidase, middle and C-terminal domains {Ochrobactrum anthropi} vkgeakhdiigryhsdeldadlllvseggaiygafegflgksdmyplysvgsdvwllpvq rsmdapspgewklvfrrddkgeitglsvgcwlargveyrrvqp
Timeline for d1ei5a2: