Lineage for d4z7ue1 (4z7u E:1-128)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033999Domain d4z7ue1: 4z7u E:1-128 [273561]
    Other proteins in same PDB: d4z7ua1, d4z7ua2, d4z7ub1, d4z7uc1, d4z7uc2, d4z7ud1, d4z7ue2, d4z7ug2
    automated match to d2ak4d1
    complexed with fuc, nag

Details for d4z7ue1

PDB Entry: 4z7u (more details), 2.7 Å

PDB Description: s13 complex
PDB Compounds: (E:) T-cell receptor, s13 alpha chain

SCOPe Domain Sequences for d4z7ue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7ue1 b.1.1.0 (E:1-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma
slaiaedrksstlilhratlrdaavyycilrdrsnqfyfgtgtsltvip

SCOPe Domain Coordinates for d4z7ue1:

Click to download the PDB-style file with coordinates for d4z7ue1.
(The format of our PDB-style files is described here.)

Timeline for d4z7ue1: