PDB entry 4z7u

View 4z7u on RCSB PDB site
Description: S13 complex
Class: immune system
Keywords: immune receptor-ligand complex, immune system
Deposited on 2015-04-08, released 2015-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z7ua1, d4z7ua2
  • Chain 'B':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z7ub1, d4z7ub2
  • Chain 'C':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z7uc1, d4z7uc2
  • Chain 'D':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z7ud1, d4z7ud2
  • Chain 'E':
    Compound: T-cell receptor, s13 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7U (0-End)
    Domains in SCOPe 2.06: d4z7ue1, d4z7ue2
  • Chain 'F':
    Compound: T-cell receptor, s13 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7U (0-End)
    Domains in SCOPe 2.06: d4z7uf1, d4z7uf2
  • Chain 'G':
    Compound: T-cell receptor, s13 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7U (0-End)
    Domains in SCOPe 2.06: d4z7ug1, d4z7ug2
  • Chain 'H':
    Compound: T-cell receptor, s13 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7U (0-End)
    Domains in SCOPe 2.06: d4z7uh1, d4z7uh2
  • Chain 'I':
    Compound: deamidated DQ8-glia-alpha1 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7U
  • Chain 'J':
    Compound: deamidated DQ8-glia-alpha1 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7U (0-End)
  • Heterogens: NAG, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z7uA (A:)
    edivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpq
    faltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkh
    wepetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7uA (A:)
    divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
    altniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhw
    ep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z7uB (B:)
    ggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvy
    ravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrte
    alnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqr
    gdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7uB (B:)
    dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
    nsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispllvcsvtdfypaqikvrw
    qeettgvvstplirngdwtfqilvmlemdvytchvehpslqnpiivewr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4z7uC (C:)
    edivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpq
    faltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkh
    wepetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7uC (C:)
    divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
    altniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhw
    ep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4z7uD (D:)
    ggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvy
    ravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrte
    alnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqr
    gdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7uD (D:)
    dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
    nsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsllvcsvtdfypaqikvr
    wqeettgvvstplirngdwtfqilvmlemrgdvytchvehpslqnpiivewr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4z7uE (E:)
    dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma
    slaiaedrksstlilhratlrdaavyycilrdrsnqfyfgtgtsltvipniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7uE (E:)
    dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma
    slaiaedrksstlilhratlrdaavyycilrdrsnqfyfgtgtsltvipniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4z7uF (F:)
    dsgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgni
    lerfsaqqfpdlhselnlsslelgdsalyfcassttpgtgtetqyfgpgtrllvledlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7uF (F:)
    dsgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgni
    lerfsaqqfpdlhselnlsslelgdsalyfcassttpgtgtetqyfgpgtrllvledlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4z7uG (G:)
    dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma
    slaiaedrksstlilhratlrdaavyycilrdrsnqfyfgtgtsltvipniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7uG (G:)
    dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma
    slaiaedrksstlilhratlrdaavyycilrdrsnqfyfgtgtsltvipniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4z7uH (H:)
    dsgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgni
    lerfsaqqfpdlhselnlsslelgdsalyfcassttpgtgtetqyfgpgtrllvledlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7uH (H:)
    dsgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgni
    lerfsaqqfpdlhselnlsslelgdsalyfcassttpgtgtetqyfgpgtrllvledlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgra
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.