SCOPe 2.05: Domain d4zk4a_: 4zk4 A:

Lineage for d4zk4a_ (4zk4 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)

8. Domain d4zk4a_: 4zk4 A: [272833]
   automated match to d3sioc_
   complexed with mg, pg4, so4, tii

Details for d4zk4a_

PDB Entry: 4zk4, 1.9 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with 7-(5-isopropoxy- pyridin-3-yl)-1-methyl-1,7-diaza-spiro[4.4]nonane

PDB Compounds: (A:) soluble acetylcholine receptor, neuronal acetylcholine receptor subunit alpha-3 chimera

SCOPe Domain Sequences for d4zk4a_:

Sequence, based on SEQRES records:

>d4zk4a_ b.96.1.0 (A:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyw
eqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsv
mfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskye
ilsatqykhdikyncceeiypdvvlvvkfrerrag

Sequence, based on observed residues (ATOM records):

>d4zk4a_ b.96.1.0 (A:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dddklhsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqqr
wklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfip
aqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsa
tqykhdikyncceeiypdvvlvvkfrerrag

Timeline for d4zk4a_:

• d4zk4a_ is new in SCOPe 2.05-stable
  
• d4zk4a_ is called d4zk4a1 in SCOPe 2.06
  
• d4zk4a_ appears in the current release, SCOPe 2.08, called d4zk4a1