Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries) |
Domain d4zk4c_: 4zk4 C: [272832] automated match to d3sioc_ complexed with mg, pg4, so4, tii |
PDB Entry: 4zk4 (more details), 1.9 Å
SCOPe Domain Sequences for d4zk4c_:
Sequence, based on SEQRES records: (download)
>d4zk4c_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} lhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqr wklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfip aqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsa tqykhdikyncceeiypdvvlvvkfre
>d4zk4c_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} lhsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwkln slmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrl sfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqyk hdikyncceeiypdvvlvvkfre
Timeline for d4zk4c_:
View in 3D Domains from other chains: (mouse over for more information) d4zk4a_, d4zk4b_, d4zk4d_, d4zk4e_ |