Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (6 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries) |
Domain d4zk4a1: 4zk4 A:1-210 [272833] Other proteins in same PDB: d4zk4a2, d4zk4b2, d4zk4c2, d4zk4d2, d4zk4e2 automated match to d3sioc_ complexed with mg, pg4, so4, tii |
PDB Entry: 4zk4 (more details), 1.9 Å
SCOPe Domain Sequences for d4zk4a1:
Sequence, based on SEQRES records: (download)
>d4zk4a1 b.96.1.0 (A:1-210) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qykhdikyncceeiypdvvlvvkfrerrag
>d4zk4a1 b.96.1.0 (A:1-210) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklns lmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrls fmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykh dikyncceeiypdvvlvvkfrerrag
Timeline for d4zk4a1: