Lineage for d4wjoa_ (4wjo A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932472Domain d4wjoa_: 4wjo A: [269066]
    automated match to d1y8rc_

Details for d4wjoa_

PDB Entry: 4wjo (more details), 1.46 Å

PDB Description: crystal structure of sumo1 in complex with pml
PDB Compounds: (A:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d4wjoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wjoa_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtp
kelgmeeedvievyqeq

SCOPe Domain Coordinates for d4wjoa_:

Click to download the PDB-style file with coordinates for d4wjoa_.
(The format of our PDB-style files is described here.)

Timeline for d4wjoa_: