Class b: All beta proteins [48724] (177 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Pepsin(ogen) [50658] (4 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50659] (8 PDB entries) |
Domain d1psab_: 1psa B: [26847] complexed with 0zl |
PDB Entry: 1psa (more details), 2.9 Å
SCOPe Domain Sequences for d1psab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psab_ b.50.1.2 (B:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi lgdvfirqyytvfdrannkvglapva
Timeline for d1psab_: