SCOPe 2.08: Domain d1psab_: 1psa B:

Lineage for d1psab_ (1psa B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Pepsin(ogen) [50658] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50659] (12 PDB entries)

8. Domain d1psab_: 1psa B: [26847]
   complexed with 0zl

Details for d1psab_

PDB Entry: 1psa, 2.9 Å

PDB Description: structure of a pepsin(slash)renin inhibitor complex reveals a novel crystal packing induced by minor chemical alterations in the inhibitor

PDB Compounds: (B:) pepsin a

SCOPe Domain Sequences for d1psab_:

Sequence; same for both SEQRES and ATOM records:

>d1psab_ b.50.1.2 (B:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva

Timeline for d1psab_:

• d1psab_ first appeared (with stable ids) in SCOP 1.55
  
• d1psab_ appears in SCOPe 2.07