Lineage for d1psab_ (1psa B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) 
Protein Pepsin(ogen) [50658] (4 species) 
Species Pig (Sus scrofa) [TaxId:9823] [50659] (7 PDB entries) 
Domain d1psab_: 1psa B: [26847]
Details for d1psab_
PDB Entry: 1psa (more details), 2.9 Å
PDB Description: structure of a pepsin(slash)renin inhibitor complex reveals a novel crystal packing induced by minor chemical alterations in the inhibitor
SCOP Domain Sequences for d1psab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psab_ b.50.1.2 (B:) Pepsin(ogen) {Pig (Sus scrofa)}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva
SCOP Domain Coordinates for d1psab_:
Click to download the PDB-style file with coordinates for d1psab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1psab_:
- d1psab_ appears in SCOP 1.57
- d1psab_ appears in the current release, SCOPe 2.08
View in 3D
