Lineage for d4jlsa_ (4jls A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891698Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species)
  7. 2891699Species Escherichia coli [TaxId:562] [53274] (7 PDB entries)
  8. 2891712Domain d4jlsa_: 4jls A: [268304]
    automated match to d1nula_
    complexed with 3ze

Details for d4jlsa_

PDB Entry: 4jls (more details), 2.2 Å

PDB Description: Crystal Structure of E. coli XGPRT in complex with (3R,4S)-4-(Guanin-9-yl)-3-hydroxypyrrolidin-1-N-ylacetylphosphonic acid
PDB Compounds: (A:) Xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4jlsa_:

Sequence, based on SEQRES records: (download)

>d4jlsa_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]}
ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
ddyvvdipqdtwieqpwdmgvvfvppisgr

Sequence, based on observed residues (ATOM records): (download)

>d4jlsa_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]}
ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvcisg
dgegfividdlvdtggtavairemypkahfvtifakpagrplvddyvvdipqdtwieqpw
dmgvvfvppisgr

SCOPe Domain Coordinates for d4jlsa_:

Click to download the PDB-style file with coordinates for d4jlsa_.
(The format of our PDB-style files is described here.)

Timeline for d4jlsa_: