Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species) |
Species Escherichia coli [TaxId:562] [53274] (7 PDB entries) |
Domain d4jlsc_: 4jls C: [268299] automated match to d1nula_ complexed with 3ze |
PDB Entry: 4jls (more details), 2.2 Å
SCOPe Domain Sequences for d4jlsc_:
Sequence, based on SEQRES records: (download)
>d4jlsc_ c.61.1.1 (C:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv ddyvvdipqdtwieqpwdmgvvfvppisgr
>d4jlsc_ c.61.1.1 (C:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvcisg dgegfividdlvdtggtavairemypkahfvtifakpagrplvddyvvdipqdtwieqpw dmgvvfvppisgr
Timeline for d4jlsc_: