SCOPe 2.08: Domain d4okca1: 4okc A:1-105

Lineage for d4okca1 (4okc A:1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.0: automated matches [191418] (1 protein)
   not a true family

6. Protein automated matches [190587] (7 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [258042] (2 PDB entries)

8. Domain d4okca1: 4okc A:1-105 [267070]
   Other proteins in same PDB: d4okca2, d4okcb2
   automated match to d4oitb_

Details for d4okca1

PDB Entry: 4okc, 2.25 Å

PDB Description: structure, interactions and evolutionary implications of a domain- swapped lectin dimer from mycobacterium smegmatis

PDB Compounds: (A:) LysM domain protein

SCOPe Domain Sequences for d4okca1:

Sequence; same for both SEQRES and ATOM records:

>d4okca1 b.78.1.0 (A:1-105) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mgdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqt
dgnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpaws

Timeline for d4okca1:

• d4okca1 first appeared in SCOPe 2.05, called d4okca_
  
• d4okca1 appears in SCOPe 2.07