SCOPe 2.06: Domain d4kple2: 4kpl E:114-405

Lineage for d4kple2 (4kpl E:114-405)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (74 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries)

8. Domain d4kple2: 4kpl E:114-405 [266568]
   Other proteins in same PDB: d4kpla1, d4kpla3, d4kplb1, d4kplb3, d4kplc1, d4kplc3, d4kpld1, d4kpld3, d4kple1, d4kple3, d4kplf1, d4kplf3, d4kplg1, d4kplg3, d4kplh1, d4kplh3
   automated match to d4il2a2
   complexed with cl, cs2, gol, kdg, mg

Details for d4kple2

PDB Entry: 4kpl, 2 Å

PDB Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg,d-mannonate and 2-keto-3-deoxy-d-gluconate

PDB Compounds: (E:) D-mannonate dehydratase

SCOPe Domain Sequences for d4kple2:

Sequence, based on SEQRES records:

>d4kple2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records):

>d4kple2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgyepadsslpaehvwste
kylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenq
eslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlasl
yhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghfla
gespghgvdideelaakypyeraslpvnrledgtlwhw

Timeline for d4kple2:

• d4kple2 first appeared in SCOPe 2.05
  
• d4kple2 appears in SCOPe 2.07
  
• d4kple2 appears in the current release, SCOPe 2.08