![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (88 species) not a true protein |
![]() | Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries) |
![]() | Domain d4kplg1: 4kpl G:4-113 [266571] Other proteins in same PDB: d4kpla2, d4kpla3, d4kplb2, d4kplb3, d4kplc2, d4kplc3, d4kpld2, d4kpld3, d4kple2, d4kple3, d4kplf2, d4kplf3, d4kplg2, d4kplg3, d4kplh2, d4kplh3 automated match to d4il2a1 complexed with cl, cs2, gol, kdg, mg |
PDB Entry: 4kpl (more details), 2 Å
SCOPe Domain Sequences for d4kplg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kplg1 d.54.1.0 (G:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]} kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d4kplg1: