![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (74 species) not a true protein |
![]() | Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries) |
![]() | Domain d4kpld2: 4kpl D:114-405 [266566] Other proteins in same PDB: d4kpla1, d4kpla3, d4kplb1, d4kplb3, d4kplc1, d4kplc3, d4kpld1, d4kpld3, d4kple1, d4kple3, d4kplf1, d4kplf3, d4kplg1, d4kplg3, d4kplh1, d4kplh3 automated match to d4il2a2 complexed with cl, cs2, gol, kdg, mg |
PDB Entry: 4kpl (more details), 2 Å
SCOPe Domain Sequences for d4kpld2:
Sequence, based on SEQRES records: (download)
>d4kpld2 c.1.11.0 (D:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw
>d4kpld2 c.1.11.0 (D:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgsslpaehvwstekylnh apklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrl irehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrt gfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespg hgvdideelaakypyeraslpvnrledgtlwhw
Timeline for d4kpld2: