SCOPe 2.05: Domain d3j38u_: 3j38 U:

Lineage for d3j38u_ (3j38 U:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)

7. Species Drosophila melanogaster [TaxId:7227] [267999] (2 PDB entries)
   Because SCOP is not case sensitive, we included upper case chains from 3j38 and 3j39 and lower case chains from 3j3a and 3j3b

8. Domain d3j38u_: 3j38 U: [264876]

Details for d3j38u_

PDB Entry: 3j38, 6 Å

PDB Description: Structure of the D. melanogaster 40S ribosomal proteins

PDB Compounds: (U:) 40S ribosomal protein S20

SCOPe Domain Sequences for d3j38u_:

Sequence; same for both SEQRES and ATOM records:

>d3j38u_ i.1.1.1 (U:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Drosophila melanogaster [TaxId: 7227]}
svhriritltsrnvrslenvcrdlingaknqnlrvkgpvrmptktlrittrktpcgegsk
twdrfqmrihkriidlhspseivkkitsiniepgvevevtia

Timeline for d3j38u_:

• d3j38u_ is new in SCOPe 2.05-stable
  
• d3j38u_ appears in SCOPe 2.06
  
• d3j38u_ appears in the current release, SCOPe 2.08