Lineage for d3j38j_ (3j38 J:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1971481Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 1971555Species Drosophila melanogaster [TaxId:7227] [267999] (2 PDB entries)
    Because SCOP is not case sensitive, we included upper case chains from 3j38 and 3j39 and lower case chains from 3j3a and 3j3b
  8. 1971591Domain d3j38j_: 3j38 J: [264865]

Details for d3j38j_

PDB Entry: 3j38 (more details), 6 Å

PDB Description: Structure of the D. melanogaster 40S ribosomal proteins
PDB Compounds: (J:) 40S ribosomal protein S9

SCOPe Domain Sequences for d3j38j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j38j_ i.1.1.1 (J:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Drosophila melanogaster [TaxId: 7227]}
gripsvfsktyvtprrpyekarldqelkiigeyglrnkrevwrvkyalakirkaarellt
ldekdekrlfqgnallrrlvrigvldesrmkldyvlglkiedflerrlqtqvfklglaks
ihharvlirqrhirvrkqvvnipsfvvrldsqkhidfslkspfgggrpgrvkrknlkknq
g

SCOPe Domain Coordinates for d3j38j_:

Click to download the PDB-style file with coordinates for d3j38j_.
(The format of our PDB-style files is described here.)

Timeline for d3j38j_: