Lineage for d1bmfd2 (1bmf D:9-81)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1129800Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1129801Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 1129802Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1129855Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 1129858Species Cow (Bos taurus) [TaxId:9913] [88678] (14 PDB entries)
    Uniprot P00829
  8. 1129880Domain d1bmfd2: 1bmf D:9-81 [26449]
    Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfa3, d1bmfb1, d1bmfb2, d1bmfb3, d1bmfc1, d1bmfc2, d1bmfc3, d1bmfd1, d1bmfd3, d1bmfe1, d1bmfe3, d1bmff1, d1bmff3, d1bmfg_
    complexed with adp, anp, mg

Details for d1bmfd2

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase
PDB Compounds: (D:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1bmfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfd2 b.49.1.1 (D:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d1bmfd2:

Click to download the PDB-style file with coordinates for d1bmfd2.
(The format of our PDB-style files is described here.)

Timeline for d1bmfd2: