Lineage for d1bmfe1 (1bmf E:358-474)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091605Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1091606Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 1091607Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1091660Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 1091663Species Cow (Bos taurus) [TaxId:9913] [88929] (14 PDB entries)
    Uniprot P00829
  8. 1091686Domain d1bmfe1: 1bmf E:358-474 [18285]
    Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfa3, d1bmfb1, d1bmfb2, d1bmfb3, d1bmfc1, d1bmfc2, d1bmfc3, d1bmfd2, d1bmfd3, d1bmfe2, d1bmfe3, d1bmff2, d1bmff3, d1bmfg_
    complexed with adp, anp, mg

Details for d1bmfe1

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase
PDB Compounds: (E:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1bmfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfe1 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOPe Domain Coordinates for d1bmfe1:

Click to download the PDB-style file with coordinates for d1bmfe1.
(The format of our PDB-style files is described here.)

Timeline for d1bmfe1: