Class a: All alpha proteins [46456] (284 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88893] (14 PDB entries) Uniprot P19483 |
Domain d1bmfa1: 1bmf A:380-510 [18281] Other proteins in same PDB: d1bmfa2, d1bmfa3, d1bmfb2, d1bmfb3, d1bmfc2, d1bmfc3, d1bmfd1, d1bmfd2, d1bmfd3, d1bmfe1, d1bmfe2, d1bmfe3, d1bmff1, d1bmff2, d1bmff3, d1bmfg_ complexed with adp, anp, mg |
PDB Entry: 1bmf (more details), 2.85 Å
SCOPe Domain Sequences for d1bmfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmfa1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d1bmfa1: