SCOPe 2.08: Domain d4r18f_: 4r18 F:

Lineage for d4r18f_ (4r18 F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d4r18f_: 4r18 F: [263797]
   Other proteins in same PDB: d4r18a_, d4r18b_, d4r18c2, d4r18e_, d4r18g_, d4r18i_, d4r18j_, d4r18k_, d4r18l_, d4r18n_, d4r18o_, d4r18q2, d4r18s_, d4r18u_, d4r18w_, d4r18x_, d4r18y_, d4r18z_
   automated match to d4g4sg_
   complexed with aba, mg

Details for d4r18f_

PDB Entry: 4r18, 2.4 Å

PDB Description: Ligand-induced Lys33-Thr1 crosslinking at subunit beta5 of the yeast 20S proteasome

PDB Compounds: (F:) Proteasome subunit alpha type-7

SCOPe Domain Sequences for d4r18f_:

Sequence; same for both SEQRES and ATOM records:

>d4r18f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d4r18f_:

• d4r18f_ first appeared in SCOPe 2.05
  
• d4r18f_ appears in SCOPe 2.07