Lineage for d4okng2 (4okn G:161-332)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232608Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (16 PDB entries)
  8. 2232641Domain d4okng2: 4okn G:161-332 [263310]
    Other proteins in same PDB: d4okna1, d4oknb1, d4oknc1, d4oknd1, d4okne1, d4oknf1, d4okng1, d4oknh1
    automated match to d4l4ra2
    complexed with kan, nai, oxl, so4

Details for d4okng2

PDB Entry: 4okn (more details), 2.1 Å

PDB Description: Crystal structure of human muscle L-lactate dehydrogenase, ternary complex with NADH and oxalate
PDB Compounds: (G:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4okng2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4okng2 d.162.1.1 (G:161-332) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4okng2:

Click to download the PDB-style file with coordinates for d4okng2.
(The format of our PDB-style files is described here.)

Timeline for d4okng2: