Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (18 species) |
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (16 PDB entries) |
Domain d4oknh1: 4okn H:2-160 [263311] Other proteins in same PDB: d4okna2, d4oknb2, d4oknc2, d4oknd2, d4okne2, d4oknf2, d4okng2, d4oknh2 automated match to d4l4ra1 complexed with kan, nai, oxl, so4 |
PDB Entry: 4okn (more details), 2.1 Å
SCOPe Domain Sequences for d4oknh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oknh1 c.2.1.5 (H:2-160) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d4oknh1: