Lineage for d4jkmb2 (4jkm B:183-275)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2036362Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2036821Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2036822Protein automated matches [254633] (8 species)
    not a true protein
  7. 2036905Species Clostridium perfringens [TaxId:195102] [267955] (1 PDB entry)
  8. 2036907Domain d4jkmb2: 4jkm B:183-275 [262761]
    Other proteins in same PDB: d4jkma1, d4jkma3, d4jkma4, d4jkmb1, d4jkmb3, d4jkmb4, d4jkmd1, d4jkmd2
    automated match to d3hn3a2

Details for d4jkmb2

PDB Entry: 4jkm (more details), 2.26 Å

PDB Description: crystal structure of clostridium perfringens beta-glucuronidase
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d4jkmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkmb2 b.1.4.0 (B:183-275) automated matches {Clostridium perfringens [TaxId: 195102]}
syieditivtdfkenngyvnyevqavgkcnikvtiideennivaegegkegkltinnvhl
wepmnaylyklkvellddeeiidtyfeefgvrt

SCOPe Domain Coordinates for d4jkmb2:

Click to download the PDB-style file with coordinates for d4jkmb2.
(The format of our PDB-style files is described here.)

Timeline for d4jkmb2: