PDB entry 4jkm

View 4jkm on RCSB PDB site
Description: Crystal Structure of Clostridium perfringens beta-glucuronidase
Class: hydrolase
Keywords: alpha/beta barrel, beta-sandwich, sugar-binding domain, glycosyl hydrolase, hydrolase
Deposited on 2013-03-09, released 2014-09-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucuronidase
    Species: Clostridium perfringens [TaxId:195102]
    Gene: bglR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XP19 (3-601)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4jkma1, d4jkma2, d4jkma3, d4jkma4
  • Chain 'B':
    Compound: beta-glucuronidase
    Species: Clostridium perfringens [TaxId:195102]
    Gene: bglR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XP19 (3-601)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4jkmb1, d4jkmb2, d4jkmb3, d4jkmb4
  • Chain 'C':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b4034, JW3994, malE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-374)
      • expression tag (375-377)
  • Chain 'D':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b4034, JW3994, malE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-374)
      • see remark 999 (24)
      • expression tag (375-378)
    Domains in SCOPe 2.06: d4jkmd1, d4jkmd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jkmA (A:)
    snamlypiitesrqlidlsgiwkfklnegnglteelskapledtiemavpssyndlvesq
    evrdhvgwvwyernftipktllnerivlrfgsatheakvylngellvehkggftpfeaei
    ndllvsgdnrltvavnniidettlpvglvkevevdgkkviknsvnfdffnyagihrpvki
    yttpksyieditivtdfkenngyvnyevqavgkcnikvtiideennivaegegkegklti
    nnvhlwepmnaylyklkvellddeeiidtyfeefgvrtvevkdgkflinnkpfyfkgfgk
    hedsyvngrgineainikdfnlmkwigansfrtshypyseeimrladregivvidetpav
    glhlnfmatgfggdapkrdtwkeigtkeaherilrelvsrdknhpcvvmwsvanepdsds
    egakeyfeplikltkeldpqkrpvtvvtylmstpdrckvgdivdvlclnryygwyvaggd
    leeakrmledelkgweercpktpimfteygadtvaglhdtvpvmfteeyqveyykanhev
    mdkcknfvgeqvwnfadfatsqgiirvqgnkkgiftrerkpkmiahslrerwtnipefgy
    kk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jkmB (B:)
    snamlypiitesrqlidlsgiwkfklnegnglteelskapledtiemavpssyndlvesq
    evrdhvgwvwyernftipktllnerivlrfgsatheakvylngellvehkggftpfeaei
    ndllvsgdnrltvavnniidettlpvglvkevevdgkkviknsvnfdffnyagihrpvki
    yttpksyieditivtdfkenngyvnyevqavgkcnikvtiideennivaegegkegklti
    nnvhlwepmnaylyklkvellddeeiidtyfeefgvrtvevkdgkflinnkpfyfkgfgk
    hedsyvngrgineainikdfnlmkwigansfrtshypyseeimrladregivvidetpav
    glhlnfmatgfggdapkrdtwkeigtkeaherilrelvsrdknhpcvvmwsvanepdsds
    egakeyfeplikltkeldpqkrpvtvvtylmstpdrckvgdivdvlclnryygwyvaggd
    leeakrmledelkgweercpktpimfteygadtvaglhdtvpvmfteeyqveyykanhev
    mdkcknfvgeqvwnfadfatsqgiirvqgnkkgiftrerkpkmiahslrerwtnipefgy
    kk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jkmD (D:)
    mkhhhhhhgkieegklviwingdkaynglaevgkkfekdtgikvtvehpdkleekfpqva
    atgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiave
    alsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafky
    engkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwa
    wsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegle
    avnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaa
    sgrqtvdealkdaqtnsssnnnnnnnnnnrdlgtenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jkmD (D:)
    iwingdkaynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwahdrfg
    gyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnppkt
    weeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdnaga
    kagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlp
    tfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalksye
    eelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqtns
    ss