| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
| Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
| Protein automated matches [226991] (9 species) not a true protein |
| Species Lactobacillus salivarius [TaxId:362948] [260147] (2 PDB entries) |
| Domain d4c7va3: 4c7v A:527-662 [260148] Other proteins in same PDB: d4c7va1, d4c7va2, d4c7va4 automated match to d3hylb3 |
PDB Entry: 4c7v (more details), 2.2 Å
SCOPe Domain Sequences for d4c7va3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7va3 c.48.1.0 (A:527-662) automated matches {Lactobacillus salivarius [TaxId: 362948]}
piskekvfdgvekggyvvqgaeneadgiliatgsevglalkakeelqkkgkdvivvslps
werfeaqseeykntvippelkkrmtieagttygwakyagdhgvmigidefgmsapsdivl
relgmsvenivdkyle
Timeline for d4c7va3: