PDB entry 4c7v

View 4c7v on RCSB PDB site
Description: Apo Tranksetolase from Lactobacillus salivarius at 2.2A resolution
Class: transferase
Keywords: transferase
Deposited on 2013-09-26, released 2014-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Lactobacillus salivarius [TaxId:362948]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1WQU8 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d4c7va1, d4c7va2, d4c7va3, d4c7va4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c7vA (A:)
    mahhhhhhssglevlfqgpydqvdqlgvntlrtlsidaiqransghpglpmgaapmayvl
    wtrhlkinpkthmnwvnrdrfvlsaghgsallyslahlagydvsmddlknfrewksntpg
    hpeygctdgveattgplgqgismavgmamaeahlgkkfnregypvmdhytyaligdgdlm
    egvaseaaslaghlklgklialydsngisldgktsasftenvgarfeaygwqyilvedgf
    nleeidkaivqakaesdkptiieikttigygsenqgthkvhgsplgeegvahakevynwn
    yppftvpeevsqrfkeclqdkgvkaenkwnemfeaykkeysdlaqkfsdgfsnkvpntlg
    dilpqygeddsiatraasqkainalakevsslwggaadlassnktviagegdfqpesyeg
    rniwfgvrefgmacamngimlhggtrifgstffvfsdylkaairlsaiqklpviyvlthd
    svavgkdgpthepieqlaslrtipnvqvfrpadgnetsaawkvaletldkptilvlsrqn
    ldtlpiskekvfdgvekggyvvqgaeneadgiliatgsevglalkakeelqkkgkdvivv
    slpswerfeaqseeykntvippelkkrmtieagttygwakyagdhgvmigidefgmsaps
    divlrelgmsvenivdkylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c7vA (A:)
    pydqvdqlgvntlrtlsidaiqransghpglpmgaapmayvlwtrhlkinpkthmnwvnr
    drfvlsaghgsallyslahlagydvsmddlknfrewksntpghpeygctdgveattgplg
    qgismavgmamaeahlgkkfnregypvmdhytyaligdgdlmegvaseaaslaghlklgk
    lialydsngisldgktsasftenvgarfeaygwqyilvedgfnleeidkaivqakaesdk
    ptiieikttigygsenqgthkvhgsplgeegvahakevynwnyppftvpeevsqrfkecl
    qdkgvkaenkwnemfeaykkeysdlaqkfsdgfsnkvpntlgdilpqygeddsiatraas
    qkainalakevsslwggaadlassnktviagegdfqpesyegrniwfgvrefgmacamng
    imlhggtrifgstffvfsdylkaairlsaiqklpviyvlthdsvavgkdgpthepieqla
    slrtipnvqvfrpadgnetsaawkvaletldkptilvlsrqnldtlpiskekvfdgvekg
    gyvvqgaeneadgiliatgsevglalkakeelqkkgkdvivvslpswerfeaqseeyknt
    vippelkkrmtieagttygwakyagdhgvmigidefgmsapsdivlrelgmsvenivdky
    le