Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.0: automated matches [227135] (1 protein) not a true family |
Protein automated matches [226836] (7 species) not a true protein |
Species Polyomavirus hpyv7 [TaxId:746831] [258722] (1 PDB entry) |
Domain d4pchc_: 4pch C: [258725] automated match to d4mbzj_ complexed with gol |
PDB Entry: 4pch (more details), 1.7 Å
SCOPe Domain Sequences for d4pchc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pchc_ b.121.6.0 (C:) automated matches {Polyomavirus hpyv7 [TaxId: 746831]} evldtvpltedtqykveavllpnfgkaattgnfqsrglpytmsdtlgpgaalcysvavin lpeipdamcedtmivweayrletellfapqmassgyqrangtlagiegtqlyfwacgggp ldviginpdperlkvnealegpgnsdvaslqalrkqvnaanfpvelwvadptkndntryf grvvgggvtppvvsygnqsttplidengvgilctfgsvyltsadmvgmtglpglptlsad ysnqrtvqagygrffrvhcrqrrik
Timeline for d4pchc_:
View in 3D Domains from other chains: (mouse over for more information) d4pcha_, d4pchb_, d4pchd_, d4pche_ |