Lineage for d4pchc_ (4pch C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1563153Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1564135Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 1564335Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 1564336Protein automated matches [226836] (6 species)
    not a true protein
  7. 1564385Species Polyomavirus hpyv7 [TaxId:746831] [258722] (1 PDB entry)
  8. 1564388Domain d4pchc_: 4pch C: [258725]
    automated match to d4mbzj_
    complexed with gol

Details for d4pchc_

PDB Entry: 4pch (more details), 1.7 Å

PDB Description: structure of human polyomavirus 7 (hpyv7) vp1 pentamer
PDB Compounds: (C:) vp1

SCOPe Domain Sequences for d4pchc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pchc_ b.121.6.0 (C:) automated matches {Polyomavirus hpyv7 [TaxId: 746831]}
evldtvpltedtqykveavllpnfgkaattgnfqsrglpytmsdtlgpgaalcysvavin
lpeipdamcedtmivweayrletellfapqmassgyqrangtlagiegtqlyfwacgggp
ldviginpdperlkvnealegpgnsdvaslqalrkqvnaanfpvelwvadptkndntryf
grvvgggvtppvvsygnqsttplidengvgilctfgsvyltsadmvgmtglpglptlsad
ysnqrtvqagygrffrvhcrqrrik

SCOPe Domain Coordinates for d4pchc_:

Click to download the PDB-style file with coordinates for d4pchc_.
(The format of our PDB-style files is described here.)

Timeline for d4pchc_: