Lineage for d1tpae_ (1tpa E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796015Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
    Uniprot P00760
  8. 2796340Domain d1tpae_: 1tpa E: [25864]
    Other proteins in same PDB: d1tpai_
    complexed with ca

Details for d1tpae_

PDB Entry: 1tpa (more details), 1.9 Å

PDB Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
PDB Compounds: (E:) anhydro-trypsin

SCOPe Domain Sequences for d1tpae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpae_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1tpae_:

Click to download the PDB-style file with coordinates for d1tpae_.
(The format of our PDB-style files is described here.)

Timeline for d1tpae_: