Class a: All alpha proteins [46456] (289 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins) Pfam PF00307 |
Protein automated matches [191021] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [258314] (1 PDB entry) |
Domain d4q57b1: 4q57 B:23-153 [258315] Other proteins in same PDB: d4q57b2, d4q57b3 automated match to d1mb8a1 complexed with ca, cl, edo, gol, mg |
PDB Entry: 4q57 (more details), 1.8 Å
SCOPe Domain Sequences for d4q57b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q57b1 a.40.1.1 (B:23-153) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dnlylavlrasegkkderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllev lsgdslprekgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiil hfqisdiqvsg
Timeline for d4q57b1: