Class a: All alpha proteins [46456] (289 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255300] (3 PDB entries) |
Domain d4q57b2: 4q57 B:154-263 [258316] Other proteins in same PDB: d4q57b1, d4q57b3 automated match to d1mb8a2 complexed with ca, cl, edo, gol, mg |
PDB Entry: 4q57 (more details), 1.8 Å
SCOPe Domain Sequences for d4q57b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q57b2 a.40.1.0 (B:154-263) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qsedmtakeklllwsqrmvegyqglrcdnfttswrdgrlfnaiihrhkpmlidmnkvyrq tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp
Timeline for d4q57b2: