PDB entry 4q57

View 4q57 on RCSB PDB site
Description: Crystal structure of the plectin 1a actin-binding domain/N-terminal domain of calmodulin complex
Class: calcium binding/structural protein
Keywords: EF-hand motif, calponin homology domain, CALCIUM BINDING-STRUCTURAL PROTEIN complex
Deposited on 2014-04-16, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Plectin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QXS1 (3-243)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4q57b1, d4q57b2, d4q57b3
  • Heterogens: CA, MG, CL, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4q57B (B:)
gpmdnlylavlrasegkkderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisl
levlsgdslprekgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwt
iilhfqisdiqvsgqsedmtakeklllwsqrmvegyqglrcdnfttswrdgrlfnaiihr
hkpmlidmnkvyrqtnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvssly
damp