SCOPe 2.06: Domain d4q57b1: 4q57 B:23-153

Lineage for d4q57b1 (4q57 B:23-153)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein automated matches [191021] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [258314] (1 PDB entry)

8. Domain d4q57b1: 4q57 B:23-153 [258315]
   Other proteins in same PDB: d4q57b2, d4q57b3
   automated match to d1mb8a1
   complexed with ca, cl, edo, gol, mg

Details for d4q57b1

PDB Entry: 4q57, 1.8 Å

PDB Description: Crystal structure of the plectin 1a actin-binding domain/N-terminal domain of calmodulin complex

PDB Compounds: (B:) Plectin

SCOPe Domain Sequences for d4q57b1:

Sequence; same for both SEQRES and ATOM records:

>d4q57b1 a.40.1.1 (B:23-153) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dnlylavlrasegkkderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllev
lsgdslprekgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiil
hfqisdiqvsg

Timeline for d4q57b1:

• d4q57b1 first appeared in SCOPe 2.04
  
• d4q57b1 appears in SCOPe 2.05
  
• d4q57b1 appears in SCOPe 2.07
  
• d4q57b1 appears in the current release, SCOPe 2.08