SCOPe 2.05: Domain d4pd4c1: 4pd4 C:1-261

Lineage for d4pd4c1 (4pd4 C:1-261)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257467] (1 PDB entry)

8. Domain d4pd4c1: 4pd4 C:1-261 [257468]
   Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
   automated match to d1kb9c2
   complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4c1

PDB Entry: 4pd4, 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d4pd4c1:

Sequence; same for both SEQRES and ATOM records:

>d4pd4c1 f.21.1.2 (C:1-261) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
alfvfyspntlghpdnyipgn

Timeline for d4pd4c1:

• d4pd4c1 first appeared in SCOPe 2.04
  
• d4pd4c1 appears in SCOPe 2.06
  
• d4pd4c1 appears in the current release, SCOPe 2.08